Rabbit Polyclonal Anti-FAM189B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C1orf2 antibody: synthetic peptide directed towards the N terminal of human C1orf2. Synthetic peptide located within the following region: PLLRPCPESGQELKVAPNSTCDEARGALKNLLFSVCGLTICAAIICTLSA |
Fam189b Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
FAM189B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FAM189B |
Germany
Japan
United Kingdom
China