Antibodies

View as table Download

FAM234A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FAM234A

Rabbit Polyclonal Anti-ITFG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITFG3 antibody: synthetic peptide directed towards the middle region of human ITFG3. Synthetic peptide located within the following region: RSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA

Carrier-free (BSA/glycerol-free) ITFG3 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

FAM234A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FAM234A

FAM234A Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 70-400 of human FAM234A (NP_114428.1).
Modifications Unmodified

ITFG3 (C16orf9) mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ITFG3 (C16orf9) mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated