Antibodies

Jump to Filters
View as table Download
FBXO3 Rabbit Polyclonal Antibody
TA329823

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-FBXO3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO3 antibody: synthetic peptide directed towards the N terminal of human FBXO3. Synthetic peptide located within the following region: NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS
FBXO3 (C-term) Rabbit Polyclonal Antibody
AP51629PU-N

USD 450.00

2 Weeks

FBXO3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 401~431 amino acids from the C-terminal region of human FBXO3.
FBXO3 Rabbit Polyclonal Antibody
TA376159

USD 220.00

3 Weeks

FBXO3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human FBXO3 (NP_036307.2).
Modifications Unmodified