Antibodies

View as table Download

Rabbit Polyclonal antibody to Flightless I (flightless I homolog (Drosophila))

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 435 and 778 of Flightless I (Uniprot ID#Q13045)

Rabbit Polyclonal Anti-FLII Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLII antibody: synthetic peptide directed towards the middle region of human FLII. Synthetic peptide located within the following region: LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR

FLII Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FLII

FLII Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-660 of human FLII (NP_002009.1).
Modifications Unmodified