Rabbit Polyclonal Anti-FNDC3A Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-FNDC3A Antibody is: synthetic peptide directed towards the N-terminal region of Human FNDC3A. Synthetic peptide located within the following region: QSSQVYGDVDAHSTHGRSNFRDERSSKTYERLQKKLKDRQGTQKDKMSSP |
FNDC3A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 900-1170 of human FNDC3A (NP_001265367.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China