Rabbit Polyclonal Anti-FYTTD1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fyttd1 antibody is: synthetic peptide directed towards the middle region of Rat Fyttd1. Synthetic peptide located within the following region: TEQLIDDVVAKRTRQTQKPRLTRTAVPSFLTKREQSDVKKIPKGVPLQFD |
Rabbit Polyclonal Anti-FYTTD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FYTTD1 antibody: synthetic peptide directed towards the middle region of human FYTTD1. Synthetic peptide located within the following region: PSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLL |
FYTTD1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FYTTD1 |
Germany
Japan
United Kingdom
China
