FAM234A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM234A |
FAM234A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM234A |
Rabbit Polyclonal Anti-ITFG3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ITFG3 antibody: synthetic peptide directed towards the middle region of human ITFG3. Synthetic peptide located within the following region: RSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA |
Carrier-free (BSA/glycerol-free) ITFG3 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FAM234A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM234A |
FAM234A Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-400 of human FAM234A (NP_114428.1). |
Modifications | Unmodified |
ITFG3 (C16orf9) mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
ITFG3 mouse monoclonal antibody,clone 3B3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
ITFG3 mouse monoclonal antibody,clone 3B3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ITFG3 (C16orf9) mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |