Fbxl3 (1-5) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Mouse |
Immunogen | Peptide sequence around aa.1~5 derived from mouse FBXL3 |
Fbxl3 (1-5) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Mouse |
Immunogen | Peptide sequence around aa.1~5 derived from mouse FBXL3 |
Rabbit polyclonal antibody to FBXL3 (F-box and leucine-rich repeat protein 3)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 309 of FBXL3 (Uniprot ID#Q9UKT7) |
Fbxl3 (1-5) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Mouse |
Immunogen | Peptide sequence around aa.1~5 derived from mouse FBXL3 |
Goat Polyclonal Antibody against FBXL3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KRGGRDSDRNSSEE-C, from the N Terminus of the protein sequence according to NP_036290.1. |
Rabbit Polyclonal Anti-FBXL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBXL3 antibody: synthetic peptide directed towards the middle region of human FBXL3. Synthetic peptide located within the following region: LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV |
Fbxl3 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |