Rabbit Polyclonal Anti-Foxc2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Foxc2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQF |
Goat Polyclonal Antibody against FOXC2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RHAAPYSYDCTKY, from the C Terminus of the protein sequence according to NP_005242.1. |
Rabbit Polyclonal anti-FOXC2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXC2 antibody: synthetic peptide directed towards the C terminal of human FOXC2. Synthetic peptide located within the following region: PQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGI |
Rabbit Polyclonal Anti-FOXC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXC2 antibody: synthetic peptide directed towards the middle region of human FOXC2. Synthetic peptide located within the following region: VIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHA |
Carrier-free (BSA/glycerol-free) FOXC2 mouse monoclonal antibody,clone OTI2G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXC2 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FOXC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FOXC2 |
FOXC2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FOXC2 |
FOXC2 mouse monoclonal antibody,clone OTI2G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXC2 mouse monoclonal antibody,clone OTI2G5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FOXC2 mouse monoclonal antibody,clone OTI2G5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FOXC2 mouse monoclonal antibody,clone OTI2G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FOXC2 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXC2 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FOXC2 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FOXC2 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
