FOXQ1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXQ1 |
FOXQ1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXQ1 |
Rabbit Polyclonal Anti-FOXQ1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: PSPLSAAGDDSLGSDGDCAANSPAAGGGARDPPGDGEQSAGGGPGAEEAI |
Rabbit Polyclonal Anti-FOXQ1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS |
Goat Polyclonal Antibody against FOXQ1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KLEVFVPRAAHGD-C, from the N Terminus of the protein sequence according to NP_150285. |
Rabbit Polyclonal Anti-FOXQ1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS |
FOXQ1 mouse monoclonal antibody, clone 2E2, Purified
Applications | ELISA, IHC |
Reactivities | Human |
Rabbit Polyclonal Anti-FOXQ1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FOXQ1 antibody is: synthetic peptide directed towards the N-terminal region of Human FOXQ1. Synthetic peptide located within the following region: PAAGGGARDTQGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGA |
Rabbit Polyclonal Anti-Foxq1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Foxq1 antibody: synthetic peptide directed towards the N terminal of mouse Foxq1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKMGSDLEGAGSSDVPSPLSAAGDDSLGSDGDCAANS |
Rabbit Polyclonal Anti-Foxq1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Foxq1 antibody: synthetic peptide directed towards the middle region of mouse Foxq1. Synthetic peptide located within the following region: ADGVFRRRRKRLSHRTTVSASGLRPEEAPPGPAGTPQPAPAARSSPIARS |
Carrier-free (BSA/glycerol-free) FOXQ1 mouse monoclonal antibody,clone OTI4D9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FOXQ1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXQ1 |
FOXQ1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human FOXQ1 |
FOXQ1 mouse monoclonal antibody,clone OTI4D9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXQ1 mouse monoclonal antibody,clone OTI4D9, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
FOXQ1 mouse monoclonal antibody,clone OTI4D9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
FOXQ1 mouse monoclonal antibody,clone OTI4D9
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |