Antibodies

Jump to Filters
View as table Download
GAPex 5 (GAPVD1) Rabbit Polyclonal Antibody
TA344118

USD 475.00

5 Days

Rabbit Polyclonal Anti-GAPVD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAPVD1 antibody: synthetic peptide directed towards the N terminal of human GAPVD1. Synthetic peptide located within the following region: FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ
GAPex 5 (GAPVD1) Rabbit Polyclonal Antibody
TA376481

USD 220.00

3 Weeks

GAPVD1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human GAPVD1 (NP_056450.2).