Antibodies

Jump to Filters
View as table Download
GIMAP5 Rabbit Polyclonal Antibody
TA315583

USD 345.00

In Stock

Rabbit polyclonal anti-GIMAP5 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GIMAP5.
GIMAP5 Rabbit Polyclonal Antibody
TA342373

USD 375.00

5 Days

Rabbit Polyclonal Anti-GIMAP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GIMAP5 antibody: synthetic peptide directed towards the middle region of human GIMAP5. Synthetic peptide located within the following region: CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL
GIMAP5 Rabbit Polyclonal Antibody
TA376567

USD 220.00

3 Weeks

GIMAP5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 190-270 of human GIMAP5 (NP_060854.2).
Modifications Unmodified