Rabbit Polyclonal Anti-GJA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJA9 antibody: synthetic peptide directed towards the middle region of human GJA9. Synthetic peptide located within the following region: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK |
Anti-GJA9 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 246-260 amino acids of Human gap junction protein, alpha 9, 59kDa |
Rabbit Polyclonal Anti-GJA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GJA9 |
Germany
Japan
United Kingdom
China
