Antibodies

Jump to Filters
View as table Download
GJC1 (GJD3) Rabbit Polyclonal Antibody
TA341675

USD 310.00

5 Days

Rabbit Polyclonal Anti-GJC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the N terminal of human GJC1. Synthetic peptide located within the following region: IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF
GJC1 (GJD3) Rabbit Polyclonal Antibody
TA355843

USD 360.00

5 Days

GJD3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated