Antibodies

Jump to Filters
View as table Download
GMEB1 Mouse Monoclonal Antibody [Clone ID: 2A8]
AM20985PU-N

USD 480.00

2 Weeks

GMEB1 mouse monoclonal antibody, clone 2A8

Applications ELISA, IF, IHC, WB
Reactivities Human
GMEB1 Rabbit Polyclonal Antibody
TA334739

USD 375.00

5 Days

Rabbit Polyclonal Anti-GMEB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GMEB1 antibody: synthetic peptide directed towards the N terminal of human GMEB1. Synthetic peptide located within the following region: EAGSENNTAVVAVETHTIHKIEEGIDTGTIEANEDMEIAYPITCGESKAI