GNAL rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human Gα olf. |
GNAL rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human Gα olf. |
Rabbit polyclonal anti-GNAL antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GNAL. |
Rabbit Polyclonal Anti-GNAL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAL antibody: synthetic peptide directed towards the C terminal of human GNAL. Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR |
Carrier-free (BSA/glycerol-free) GNAL mouse monoclonal antibody,clone OTI1C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAL mouse monoclonal antibody,clone OTI2F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAL mouse monoclonal antibody,clone OTI6A2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAL mouse monoclonal antibody,clone OTI4F2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human GNAL (NP_892023.1). |
Modifications | Unmodified |
GNAL Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human GNAL (NP_892023.1). |
Modifications | Unmodified |
GNAL mouse monoclonal antibody,clone OTI1C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GNAL mouse monoclonal antibody,clone OTI1C11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GNAL mouse monoclonal antibody,clone OTI1C11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GNAL mouse monoclonal antibody,clone OTI1C11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL mouse monoclonal antibody,clone OTI2F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL mouse monoclonal antibody,clone OTI2F3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GNAL mouse monoclonal antibody,clone OTI2F3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GNAL mouse monoclonal antibody,clone OTI2F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL mouse monoclonal antibody,clone OTI6A2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL mouse monoclonal antibody,clone OTI6A2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GNAL mouse monoclonal antibody,clone OTI6A2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GNAL mouse monoclonal antibody,clone OTI6A2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL mouse monoclonal antibody,clone OTI4F2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAL mouse monoclonal antibody,clone OTI4F2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GNAL mouse monoclonal antibody,clone OTI4F2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GNAL mouse monoclonal antibody,clone OTI4F2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |