GPR137 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Dog, Gorilla, Horse, Human, Monkey, Mouse, Pig, Rat |
| Immunogen | GPR137 antibody was raised against synthetic 17 amino acid peptide from 1st extracellular domain of human GPR137. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Elephant, Panda, Horse, Pig (100%); Bovine (94%). |
GPR137 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Immunogen | GPR137 antibody was raised against synthetic 16 amino acid peptide from 2nd cytoplasmic domain of human GPR137. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Elephant, Panda, Horse, Pig (100%); Hamster (81%). |
Rabbit Polyclonal Anti-GPR137 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR137 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR137. Synthetic peptide located within the following region: ESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLY |
GPR137 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPR137 |
Germany
Japan
United Kingdom
China
