Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR34 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: KGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNL |
Rabbit Polyclonal Anti-GPR34 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: SFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLH |
Rabbit Polyclonal Anti-GPR34 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPR34 antibody was raised against synthetic 17 amino acid peptide from 2nd cytoplasmic domain of human GPR34. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Bovine, Horse (100%); Marmoset, Mouse, Rat, Elephant, Guinea pig (94%); Panda (88%); Bat, Opossum (82%). |
GPR34 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GPR34. |
Active filters
Target Symbol
- GPR34