Rabbit Polyclonal Anti-GPRASP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-GPRASP2 antibody: synthetic peptide directed towards the middle region of human GPRASP2. Synthetic peptide located within the following region: EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ |
GPRASP2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPRASP2 antibody is: synthetic peptide directed towards the C-terminal region of Human GASP2 |
GPRASP2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GPRASP2 |
Germany
Japan
United Kingdom
China
