GAS2L3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GAS2L3 |
GAS2L3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GAS2L3 |
Rabbit polyclonal Anti-GAS2L3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GAS2L3 antibody is: synthetic peptide directed towards the N-terminal region of HUMAN GAS2L3. Synthetic peptide located within the following region: SISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGDKIL |