Rabbit Polyclonal GBP6 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | GBP6 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human GBP6. |
Rabbit Polyclonal GBP6 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | GBP6 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human GBP6. |
Rabbit Polyclonal Anti-GBP6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GBP6 Antibody is: synthetic peptide directed towards the N-terminal region of Human GBP6. Synthetic peptide located within the following region: MWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLCSTFVYN |