GMEB1 mouse monoclonal antibody, clone 2A8
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
GMEB1 mouse monoclonal antibody, clone 2A8
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-GMEB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GMEB1 antibody: synthetic peptide directed towards the N terminal of human GMEB1. Synthetic peptide located within the following region: EAGSENNTAVVAVETHTIHKIEEGIDTGTIEANEDMEIAYPITCGESKAI |