Rabbit anti-GNAO1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GNAO1 |
Rabbit anti-GNAO1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GNAO1 |
G0 Protein alpha (GNAO1) (345-354) rabbit polyclonal antibody, Ig Fraction
Applications | ELISA, IHC, WB |
Reactivities | Drosophila, Mouse |
Immunogen | Synthetic peptide KLH- conjugated corresponding to amino acids 345-354 of the native molecule |
Rabbit Polyclonal Anti-GNAO1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL |
Rabbit polyclonal GNAO1 Antibody (C-term)
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GNAO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 291-320 amino acids from the C-terminal region of human GNAO1. |
Gnao1 (345-354) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Mouse |
Immunogen | Synthetic peptide corresponding to the amino acids 345 - 354 of the native molecule conjugated to Keyhole Limpet Haemocyanin |
Rabbit Polyclonal Anti-GNAO1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the N terminal of human GNAO1. Synthetic peptide located within the following region: PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF |