Rabbit Polyclonal Anti-GNAZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAZ antibody: synthetic peptide directed towards the N terminal of human GNAZ. Synthetic peptide located within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT |
Rabbit Polyclonal Anti-Gz-alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gz-alpha Antibody: A synthesized peptide derived from human Gz-alpha |
GNAZ (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 84~114 amino acids from the N-terminal region of Human G protein z alpha |
Anti-GNAZ Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human guanine nucleotide binding protein (G protein), alpha z polypeptide |
Anti-GNAZ Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 4-18 amino acids of Human guanine nucleotide binding protein (G protein), alpha z polypeptide |
Anti-GNAZ Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 4-18 amino acids of Human guanine nucleotide binding protein (G protein), alpha z polypeptide |
GNAZ rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GNAZ |
GNAZ Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-355 of human GNAZ (NP_002064.1). |
| Modifications | Unmodified |
GNAZ Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GNAZ (NP_002064.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
