Antibodies

View as table Download

Rabbit Polyclonal Anti-GPATCH4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-GPATCH4 antibody is: synthetic peptide directed towards the C-terminal region of Human GPATCH4. Synthetic peptide located within the following region: KKRRHQEGKVSDEREGTTKGNEKEDAAGTSGLGELNSREQTNQSLRKGKK

Rabbit Polyclonal Anti-GPATCH4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-GPATCH4 antibody is: synthetic peptide directed towards the N-terminal region of Human GPATCH4. Synthetic peptide located within the following region: KPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQ