Germany
Japan
United Kingdom
China
Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2. |
Antibodies
View as table Download
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK |
Carrier-free (BSA/glycerol-free) HLA-DQA2 mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA-DQA2 mouse monoclonal antibody,clone OTI4C9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HLA-DQA2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HLA-DQA2 |
HLA-DQA2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-125 of human HLA-DQA2 (NP_064440.1). |
| Modifications | Unmodified |
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- HLA-DQA2