Rabbit Polyclonal Anti-HTATIP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTATIP2 antibody: synthetic peptide directed towards the N terminal of human HTATIP2. Synthetic peptide located within the following region: TGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYA |
Goat Polyclonal Antibody against HTATIP2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AETEALSKLREDFR-C, from the N Terminus of the protein sequence according to NP_006401. |
Rabbit Polyclonal Anti-HTATIP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTATIP2 antibody: synthetic peptide directed towards the N terminal of human HTATIP2. Synthetic peptide located within the following region: FRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYK |
Rabbit Polyclonal Anti-HTATIP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HTATIP2 |
HTATIP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human HTATIP2 (NP_006401.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
