Rabbit Polyclonal Anti-HDDC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HDDC3 Antibody: synthetic peptide directed towards the middle region of human HDDC3. Synthetic peptide located within the following region: TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI |
Rabbit Polyclonal Anti-Hddc3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Hddc3 Antibody is: synthetic peptide directed towards the middle region of Rat Hddc3. Synthetic peptide located within the following region: EVELHFGAQVRRLVEEVTDDKTLPKLERKRQQVEQAPHSSPGAKLVKLAD |
Germany
Japan
United Kingdom
China