Rabbit Polyclonal Anti-HMG20A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF |
Rabbit Polyclonal Anti-HMG20A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the C terminal of human HMG20A. Synthetic peptide located within the following region: SMPLPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR |
Goat Anti-HMG20A Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ATVREVVNRLDR, from the C Terminus of the protein sequence according to NP_060670.1. |
Rabbit Polyclonal anti-HMG20A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPE |
Rabbit Polyclonal Anti-HMG20A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK |
Rabbit Polyclonal Anti-HMG20A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK |
Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HMG20A mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HMG20A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HMG20A |
HMG20A Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-347 of human HMG20A (NP_060670.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
HMG20A mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
