Germany
Japan
United Kingdom
China
HMX2 mouse monoclonal antibody, clone 1B10, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Antibodies
View as table Download
HMX2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of mouse HMX2. |
Rabbit Polyclonal Anti-HMX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMX2 antibody: synthetic peptide directed towards the middle region of human HMX2. Synthetic peptide located within the following region: SPSHSDFKEEKERLLPAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRS |
Active filters
Target Symbol
- HMX2