HOXB5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB5 |
HOXB5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB5 |
Rabbit Polyclonal anti-HOXB5 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXB5 antibody: synthetic peptide directed towards the N terminal of human HOXB5. Synthetic peptide located within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN |
Rabbit Polyclonal Anti-HOXB5 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXB5 antibody: synthetic peptide directed towards the N terminal of human HOXB5. Synthetic peptide located within the following region: DPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRF |
Rabbit Polyclonal Anti-HOXB5 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXB5 Antibody: A synthesized peptide derived from human HOXB5 |
Hoxb5 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
HOXB5 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB5 |