Antibodies

Jump to Filters
View as table Download
HSBP1 Rabbit Monoclonal Antibody [Clone ID: OTIR5C4]
TA591020

USD 428.00

In Stock

Rabbit monoclonal anti-HSBP1 antibody for SISCAPA, clone OTIR5C4

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HSBP1 Rabbit Polyclonal Antibody
TA339061

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSBP1 antibody: synthetic peptide directed towards the N terminal of human HSBP1. Synthetic peptide located within the following region: AETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKN