Rabbit Polyclonal Anti-CPSF3L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CPSF3L Antibody is: synthetic peptide directed towards the C-terminal region of Human CPSF3L. Synthetic peptide located within the following region: TESTYATTIRDSKRCRERDFLKKVHETVERGGKGAHEPEGAHLLLHGADR |
INTS11 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human CPSF3L |
INTS11 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human INTS11 |
Germany
Japan
United Kingdom
China
