Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-IPO8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IPO8 antibody is: synthetic peptide directed towards the C-terminal region of Human IPO8. Synthetic peptide located within the following region: PPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE |
Goat Polyclonal Anti-RANBP8 / IPO8 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SAFNFGTVPSNN, from the C Terminus of the protein sequence according to NP_006381.2; NP_001177924.1. |
IPO8 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 878-1037 of human IPO8 (NP_006381.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IPO8