Antibodies

View as table Download

IL16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL16

Rabbit anti-IL16 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IL16

Rabbit Polyclonal IL-16 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-16 antibody was raised against a 20 amino acid peptide near the amino terminus of human IL-16.

Rabbit Polyclonal IL-16 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-16 antibody was raised against a 14 amino acid peptide near the amino terminus of human IL-16.

Rabbit Polyclonal IL16 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

IL16 mouse monoclonal antibody, clone 59, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal antibody to IL16 (interleukin 16 (lymphocyte chemoattractant factor))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1268 and 1332 of IL16 (Uniprot ID#Q14005)

Anti-Human IL-16 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-16 (129 a.a.)

IL16 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human

IL16 mouse monoclonal antibody, clone 323, HRP

Applications ELISA
Reactivities Human
Conjugation HRP

IL16 mouse monoclonal antibody, clone 210, Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

IL16 mouse monoclonal antibody, clone 568, Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

IL16 mouse monoclonal antibody, clone 572, Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Biotinylated Anti-Human IL-16 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-16 (129 a.a.)

Rabbit Polyclonal Anti-IL16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL16 antibody is: synthetic peptide directed towards the C-terminal region of Human IL16. Synthetic peptide located within the following region: EILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Recombinant Anti-IL-16 (Clone 14.1)

Applications ELISA, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-IL-16 (Clone 14.1)

Applications ELISA, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.