Antibodies

View as table Download

Rabbit Polyclonal IL-22 Receptor Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen IL-22 receptor antibody was raised against a synthetic peptide corresponding to amino acids near the amino terminus of human IL-22 receptor precursor .

Rabbit Polyclonal Anti-IL22RA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL22RA1 antibody: synthetic peptide directed towards the middle region of human IL22RA1. Synthetic peptide located within the following region: YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ

Rabbit Polyclonal IL-22 Receptor Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen IL-22 receptor antibody was raised against a synthetic peptide corresponding to amino acids 560 to 574 of human IL-22 receptor precursor.

Rabbit Polyclonal Anti-IL22RA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL22RA1 antibody: synthetic peptide directed towards the middle region of human IL22RA1. Synthetic peptide located within the following region: DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE

Anti-IL22RA1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-228 amino acids of human interleukin 22 receptor, alpha 1

Anti-IL22RA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-228 amino acids of human interleukin 22 receptor, alpha 1

IL22RA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human IL22RA1
Modifications Unmodified