Rabbit Polyclonal INCA1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | INCA1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human INCA1. |
Rabbit Polyclonal INCA1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | INCA1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human INCA1. |
Rabbit Polyclonal Anti-FAM212A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAM212A antibody is: synthetic peptide directed towards the middle region of Human FAM212A. Synthetic peptide located within the following region: RAPVASVPPVHHPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVL |