Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KDM2A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KDM2A antibody is: synthetic peptide directed towards the middle region of Human KDM2A. Synthetic peptide located within the following region: LTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLS |
Rabbit Polyclonal anti-FBXL11 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXL11 antibody: synthetic peptide directed towards the N terminal of human FBXL11. Synthetic peptide located within the following region: RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTF |
Goat Anti-KDM2A (aa445-459) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRKDRQVHLTHFELE, from the internal region of the protein sequence according to NP_036440.1. |
KDM2A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KDM2A |
KDM2A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KDM2A. |
Active filters
Target Symbol
- KDM2A