Antibodies

Jump to Filters
View as table Download
KIAA0020 (PUM3) Rabbit Polyclonal Antibody
TA345758

USD 410.00

5 Days

Rabbit Polyclonal Anti-KIAA0020 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the N terminal of human KIAA0020. Synthetic peptide located within the following region: GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW
KIAA0020 (PUM3) Rabbit Polyclonal Antibody
TA345757

USD 475.00

5 Days

Rabbit Polyclonal Anti-KIAA0020 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the middle region of human KIAA0020. Synthetic peptide located within the following region: PAHTVREIIEVLQKGDGNAHSKKDTEVRRRELLESISPALLSYLQEHAQE