Rabbit Polyclonal Anti-KIR3DS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KIR3DS1 antibody is: synthetic peptide directed towards the middle region of Human KIR3DS1. Synthetic peptide located within the following region: IMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYG |
KIR3DS1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KIR3DS1 |
KIR3DS1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-340 of human KIR3DS1 (NP_001077008.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China