Rabbit Polyclonal Anti-UTX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UTX antibody: synthetic peptide directed towards the N terminal of human UTX. Synthetic peptide located within the following region: MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALG |
Rabbit Polyclonal Anti-UTX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UTX antibody: synthetic peptide directed towards the middle region of human UTX. Synthetic peptide located within the following region: KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS |
Utx Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China