Antibodies

Jump to Filters
View as table Download
KLHL13 Rabbit Polyclonal Antibody
TA337273

USD 375.00

5 Days

Rabbit Polyclonal Anti-KLHL13 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL13 antibody: synthetic peptide directed towards the N terminal of human KLHL13. Synthetic peptide located within the following region: KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLS
KLHL13 Rabbit Polyclonal Antibody
TA377851

USD 220.00

3 Weeks

KLHL13 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human KLHL13 (NP_277030.2).
Modifications Unmodified