Rabbit Polyclonal Anti-KRT13 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT13 antibody: synthetic peptide directed towards the C terminal of human KRT13. Synthetic peptide located within the following region: EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP |
KRT13 (+ KRT10) mouse monoclonal antibody, clone DE-K13, Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Canine, Feline, Human, Zebrafish |
Rabbit Polyclonal Anti-KRT13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT13 antibody: synthetic peptide directed towards the N terminal of human KRT13. Synthetic peptide located within the following region: TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY |
KRT13 mouse monoclonal antibody, clone Ks13.1, Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Human, Rat |
KRT13 mouse monoclonal antibody, clone CK-13, Purified
| Applications | IHC |
| Reactivities | Human |
KRT13 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human KRT13 |
Goat Anti-KRT13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TSNASGRRTSDVRRP, from the C Terminus of the protein sequence according to NP_705694.2. |
Anti-KRT13 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 274-412 amino acids of human keratin 13 |
Cytokeratin 13 (KRT13) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2). |
| Modifications | Unmodified |
Cytokeratin 13 (KRT13) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
