Rabbit Polyclonal Anti-KTI12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KTI12 antibody is: synthetic peptide directed towards the C-terminal region of Human KTI12. Synthetic peptide located within the following region: GAAESPALVTPDSEKSAKHGSGAFYSPELLEALTLRFEAPDSRNRWDRPL |
Rabbit Polyclonal Anti-KTI12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KTI12 antibody is: synthetic peptide directed towards the middle region of Human KTI12. Synthetic peptide located within the following region: VPKELEREESGAAESPALVTPDSEKSAKHGSGAFYSPELLEALTLRFEAP |
Germany
Japan
United Kingdom
China