Antibodies

Jump to Filters
View as table Download
LAS1L Rabbit Polyclonal Antibody
TA337260

USD 375.00

5 Days

Rabbit Polyclonal Anti-LAS1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LAS1L antibody is: synthetic peptide directed towards the middle region of Human LAS1L. Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
LAS1L Rabbit Polyclonal Antibody
TA337261

USD 310.00

5 Days

Rabbit Polyclonal Anti-LAS1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAS1L antibody: synthetic peptide directed towards the C terminal of human LAS1L. Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE