LAYN mouse monoclonal antibody, clone AT20G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
LAYN mouse monoclonal antibody, clone AT20G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
LAYN mouse monoclonal antibody, clone AT20G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-LAYN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LAYN antibody: synthetic peptide directed towards the N terminal of human LAYN. Synthetic peptide located within the following region: CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL |
Carrier-free (BSA/glycerol-free) LAYN mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LAYN mouse monoclonal antibody, clone OTI4D3 (formerly 4D3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LAYN rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LAYN |
LAYN Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human LAYN. AA range:71-120 |
LAYN mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
LAYN mouse monoclonal antibody, clone OTI4C11 (formerly 4C11), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
LAYN mouse monoclonal antibody, clone OTI4C11 (formerly 4C11), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
LAYN mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LAYN mouse monoclonal antibody, clone OTI4D3 (formerly 4D3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
LAYN mouse monoclonal antibody,clone 4D3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LAYN mouse monoclonal antibody,clone 4D3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LAYN mouse monoclonal antibody, clone OTI4D3 (formerly 4D3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |