Antibodies

Jump to Filters
View as table Download
Lmtk3 Rabbit Polyclonal Antibody
TA332281

USD 375.00

5 Days

Rabbit Polyclonal Anti-Lmtk3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Lmtk3 Antibody is: synthetic peptide directed towards the middle region of Mouse Lmtk3. Synthetic peptide located within the following region: RGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQETPTNELSVQGT