Antibodies

Jump to Filters
View as table Download
LYPD4 Rabbit Polyclonal Antibody
TA344254

USD 475.00

5 Days

Rabbit Polyclonal Anti-LYPD4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYPD4 antibody: synthetic peptide directed towards the N terminal of human LYPD4. Synthetic peptide located within the following region: MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM
LYPD4 (Center) Rabbit Polyclonal Antibody
AP52568PU-N

USD 450.00

2 Weeks

LYPD4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 111-141 amino acids from the Central region of human LYPD4
LYPD4 Rabbit Polyclonal Antibody
TA365310

USD 380.00

4 Weeks

LYPD4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
LYPD4 Rabbit Polyclonal Antibody
TA369630

USD 380.00

4 Weeks

LYPD4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein