Goat Anti-LARGE (aa421-433) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SEADVNSENLQKQ, from the internal region of the protein sequence according to NP_004728.1. |
Goat Anti-LARGE (aa421-433) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SEADVNSENLQKQ, from the internal region of the protein sequence according to NP_004728.1. |
Rabbit Polyclonal Anti-LARGE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LARGE antibody: synthetic peptide directed towards the middle region of human LARGE. Synthetic peptide located within the following region: AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE |