Antibodies

Jump to Filters
View as table Download
LARP4 Rabbit Polyclonal Antibody
TA343967

USD 475.00

5 Days

Rabbit Polyclonal Anti-LARP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LARP4 antibody: synthetic peptide directed towards the middle region of human LARP4. Synthetic peptide located within the following region: VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQ
LARP4 Rabbit Polyclonal Antibody
TA377956

USD 220.00

3 Weeks

LARP4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human LARP4 (NP_443111.4).
Modifications Unmodified